CacheBy
Thermo Fisher Scientific ANGPTL2 Polyclonal Antibody
원본

Thermo Fisher Scientific ANGPTL2 Polyclonal Antibody

상품 한눈에 보기

ANGPTL2 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody. Western blot과 IHC(P)에서 검증됨. 항원 친화 크로마토그래피로 정제된 고순도 제품. 인간, 마우스, 랫트 반응성. 연구용으로만 사용 가능.

카탈로그번호
PA578776
판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오후 08:31
Thermo Fisher Scientific PA578776 ANGPTL2 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific ANGPTL2 Polyclonal Antibody

Applications

Application Tested Dilution
Western Blot (WB) 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P)) 0.5–1 µg/mL

Product Specifications

항목 내용
Species Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human ANGPTL2 (275–312aa WRDCLQALEDGHDTSSIYLVKPENTNRLMQVWCDQRHD)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS with 4 mg trehalose
Contains 0.05 mg sodium azide
Storage Conditions −20°C
Shipping Conditions Wet ice
RRID AB_2745892

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

Angiopoietins are members of the vascular endothelial growth factor family and are specific for vascular endothelium. Angiopoietin-1, -2, and -4 participate in blood vessel formation. ANGPTL2 is another angiopoietin family member, widely expressed in adult tissues, with highest mRNA levels in highly vascularized tissues. It is a secretory protein that does not act as an endothelial cell mitogen in vitro.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

제품 이미지

(이미지 파일: PA5-78776_ANGPTL2_Q9UKU9-1_Rabbit.svg, PA5-78776_ANGPTL2_Q9UKU9-1_Rabbit_PDP.jpeg)

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.