Thermo Fisher Scientific ANGPTL2 Polyclonal Antibody
ANGPTL2 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody. Western blot과 IHC(P)에서 검증됨. 항원 친화 크로마토그래피로 정제된 고순도 제품. 인간, 마우스, 랫트 반응성. 연구용으로만 사용 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human ANGPTL2 (275–312aa WRDCLQALEDGHDTSSIYLVKPENTNRLMQVWCDQRHD) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2745892 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Angiopoietins are members of the vascular endothelial growth factor family and are specific for vascular endothelium. Angiopoietin-1, -2, and -4 participate in blood vessel formation. ANGPTL2 is another angiopoietin family member, widely expressed in adult tissues, with highest mRNA levels in highly vascularized tissues. It is a secretory protein that does not act as an endothelial cell mitogen in vitro.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 파일: PA5-78776_ANGPTL2_Q9UKU9-1_Rabbit.svg, PA5-78776_ANGPTL2_Q9UKU9-1_Rabbit_PDP.jpeg)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific Annexin A10 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Betatrophin Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ANGPTL2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ANGPTL1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific alpha Amylase 1 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|