Thermo Fisher Scientific alpha Amylase 1 Polyclonal Antibody
Thermo Fisher Scientific의 alpha Amylase 1 폴리클로날 항체는 인간, 생쥐, 랫트 반응성을 가지며 WB와 IHC(P) 실험에 적합합니다. 항원 친화 크로마토그래피로 정제된 비결합 항체로, 효소 분석 및 소화 관련 연구에 활용됩니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific alpha Amylase 1 Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P))
- Tested Dilution: 0.5–1 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human Alpha Amylase 1 (20–50aa NTQQGRTSIVHLFEWRWVDIALECERYLAPK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745887 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Amylase is an enzyme that catalyzes the breakdown of starch into sugars. It is present in human saliva, initiating the chemical process of digestion. Through in situ hybridization and cytogenetic mapping, the amylase gene is located at 1p21. Amylase enzymes are used in bread making and in converting complex sugars such as starch into simple sugars. Yeast utilizes these sugars to produce alcohol and CO₂.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.