
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-AIP Antibody
상품 한눈에 보기
Human AIP 단백질을 인식하는 토끼 폴리클로날 항체로, aryl hydrocarbon receptor interacting protein 연구에 적합합니다. ICC 등 다양한 응용에 추천되며, 정제된 고품질 항체입니다. ARA9, FKBP16, XAP2 대체 유전자명으로도 알려져 있습니다.
- 카탈로그번호
- HPA050217-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA050217-100 Anti-AIP Antibody, aryl hydrocarbon receptor interacting protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050217-25 Anti-AIP Antibody, aryl hydrocarbon receptor interacting protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-AIP Antibody
Anti-AIP Antibody
Target: aryl hydrocarbon receptor interacting protein (AIP)
Type: Polyclonal Antibody against Human AIP
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human AIP (aryl hydrocarbon receptor interacting protein).
Alternative Gene Names
ARA9, FKBP16, XAP2
Target Information
- Target Protein: aryl hydrocarbon receptor interacting protein
- Target Gene: AIP
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence:
MTDEEKAKAVPLIHQEGNRLYREGHVKEAAAKYYDAIACLKNLQMKEQPGSPEWIQLDKQITPLLLNYCQCKLVVEEYYEVLDHCSSILNKYDDNVKAYFKRGKAHAAVWNAQEAQADFAKVLELDPALAPVVSRELQALE
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat (ENSRNOG00000022289): 96%
- Mouse (ENSMUSG00000097319): 95%
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Storage | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Determine optimal concentration and conditions experimentally.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.




