CacheBy
Atlas Antibodies Anti-AIP Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-AIP Antibody

상품 한눈에 보기

Human AIP 단백질을 인식하는 토끼 폴리클로날 항체로, aryl hydrocarbon receptor interacting protein 연구에 적합합니다. ICC 등 다양한 응용에 추천되며, 정제된 고품질 항체입니다. ARA9, FKBP16, XAP2 대체 유전자명으로도 알려져 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA050217-100 Anti-AIP Antibody, aryl hydrocarbon receptor interacting protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050217-25 Anti-AIP Antibody, aryl hydrocarbon receptor interacting protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-AIP Antibody

Anti-AIP Antibody

Target: aryl hydrocarbon receptor interacting protein (AIP)
Type: Polyclonal Antibody against Human AIP

  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human AIP (aryl hydrocarbon receptor interacting protein).

Alternative Gene Names

ARA9, FKBP16, XAP2

Open Datasheet (PDF)

Target Information

  • Target Protein: aryl hydrocarbon receptor interacting protein
  • Target Gene: AIP
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Epitope Sequence:
MTDEEKAKAVPLIHQEGNRLYREGHVKEAAAKYYDAIACLKNLQMKEQPGSPEWIQLDKQITPLLLNYCQCKLVVEEYYEVLDHCSSILNKYDDNVKAYFKRGKAHAAVWNAQEAQADFAKVLELDPALAPVVSRELQALE

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat (ENSRNOG00000022289): 96%
  • Mouse (ENSMUSG00000097319): 95%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Storage Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Material Safety Data Sheet (MSDS)

Notes

  • Gently mix before use.
  • Determine optimal concentration and conditions experimentally.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.