
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-AIPL1 Antibody
상품 한눈에 보기
Human AIPL1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 40% 글리세롤 및 PBS 완충액에 보존됩니다. LCA4 유전자 연구 및 단백질 발현 분석에 활용 가능합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA026578-100 Anti-AIPL1 Antibody, aryl hydrocarbon receptor interacting protein-like 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026578-25 Anti-AIPL1 Antibody, aryl hydrocarbon receptor interacting protein-like 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-AIPL1 Antibody
Anti-AIPL1 Antibody
Target: aryl hydrocarbon receptor interacting protein-like 1 (AIPL1)
Type: Polyclonal Antibody against Human AIPL1
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human AIPL1.
Alternative gene name: LCA4
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | aryl hydrocarbon receptor interacting protein-like 1 |
| Target Gene | AIPL1 |
| Alternative Gene Names | LCA4 |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000007889 (39%), Mouse ENSMUSG00000040554 (39%) |
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence:
AEVWNEAEAKADLQKVLELEPSMQKAVRRELRLLENRMAEKQEEERLRCRNMLSQGATQPPAEPPTEPPAQSSTEPPAEPPTAPSAELSAGPPAEPATEPPPSPGHSLQH
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



