
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-AIMP2 Antibody
상품 한눈에 보기
Human AIMP2 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC, WB, ICC에 적합. Human, Mouse, Rat에 반응하며, PrEST 항원을 이용해 Affinity Purified. 40% glycerol 기반 버퍼로 안정화된 고품질 항체.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA020057-100 Anti-AIMP2 Antibody, aminoacyl tRNA synthetase complex-interacting multifunctional protein 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA020057-25 Anti-AIMP2 Antibody, aminoacyl tRNA synthetase complex-interacting multifunctional protein 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-AIMP2 Antibody
Anti-AIMP2 Antibody
Target: aminoacyl tRNA synthetase complex-interacting multifunctional protein 2 (AIMP2)
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human AIMP2.
Alternative Gene Names
JTV-1, JTV1, p38, PRO0992
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | aminoacyl tRNA synthetase complex-interacting multifunctional protein 2 |
| Target Gene | AIMP2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | APLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTTLTTNAL |
Verified Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000001044 | 86% |
| Mouse | ENSMUSG00000029610 | 84% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



