CacheBy
Atlas Antibodies Anti-AIMP2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-AIMP2 Antibody

상품 한눈에 보기

Human AIMP2 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. Rabbit에서 생산된 IgG 항체이며, Affinity purification으로 높은 특이성과 순도를 제공. Human, Mouse, Rat 반응성 검증 완료.

카탈로그번호
HPA019098-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA019098-100 Anti-AIMP2 Antibody, aminoacyl tRNA synthetase complex-interacting multifunctional protein 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019098-25 Anti-AIMP2 Antibody, aminoacyl tRNA synthetase complex-interacting multifunctional protein 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-AIMP2 Antibody

Anti-AIMP2 Antibody

Target Protein: aminoacyl tRNA synthetase complex-interacting multifunctional protein 2
Target Gene: AIMP2
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human AIMP2.

Alternative Gene Names: JTV-1, JTV1, p38, PRO0992
Open Datasheet


Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

APLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTTLTTNAL

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000001044 (86%)
  • Mouse ENSMUSG00000029610 (84%)

Buffer Composition

40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Material Safety Data Sheet


Purification Method

Affinity purified using the PrEST antigen as affinity ligand.


Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.