Atlas Antibodies Anti-LRCH3 Antibody

상품 한눈에 보기

Human LRCH3 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용한 친화정제 방식으로 높은 특이성과 재현성을 제공합니다. Human과 Mouse 반응성이 검증되었습니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA017299-100 Anti-LRCH3 Antibody, leucine-rich repeats and calponin homology (CH) domain containing 3 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA017299-25 Anti-LRCH3 Antibody, leucine-rich repeats and calponin homology (CH) domain containing 3 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: leucine-rich repeats and calponin homology (CH) domain containing 3
Supplier: Atlas Antibodies

Polyclonal antibody against Human LRCH3.

항목	내용
Target Protein	leucine-rich repeats and calponin homology (CH) domain containing 3
Target Gene	LRCH3
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	HASPLPPSAAPTTDSTDSITGQNSRQREEELELIDQLRKHIEYRLKVSLPCDLGAALTDGVVLCHLANHVRPRSVPSIHVPSP

Verified: Human, Mouse
Interspecies Information:
- Mouse ENSMUSG00000022801 (86%)
- Rat ENSRNOG00000001774 (84%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen as affinity ligand