CacheBy
Atlas Antibodies Anti-LRCH3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LRCH3 Antibody

상품 한눈에 보기

Human LRCH3 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. PrEST 항원으로 정제되었으며, 사람 및 생쥐 반응성이 검증되었습니다. 40% 글리세롤 PBS 버퍼에 보존제를 포함합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA012380-100 Anti-LRCH3 Antibody, leucine-rich repeats and calponin homology (CH) domain containing 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA012380-25 Anti-LRCH3 Antibody, leucine-rich repeats and calponin homology (CH) domain containing 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LRCH3 Antibody

Anti-LRCH3 Antibody

Target: leucine-rich repeats and calponin homology (CH) domain containing 3
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human LRCH3 protein.


Alternative Gene Names

  • MGC4126

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein leucine-rich repeats and calponin homology (CH) domain containing 3
Target Gene LRCH3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence HASPLPPSAAPTTDSTDSITGQNSRQREEELELIDQLRKHIEYRLKVSLPCDLGAALTDGVVLCHLANHVRPRSVPSIHVPSP
Verified Species Reactivity Human, Mouse
Interspecies Identity Mouse ENSMUSG00000022801 (86%), Rat ENSRNOG00000001774 (84%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Application - IHC
Recommended Application - WB
Recommended Application - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.