CacheBy
Atlas Antibodies Anti-LRCH4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LRCH4 Antibody

상품 한눈에 보기

Human LRCH4 단백질을 인식하는 폴리클로날 래빗 항체로, IHC 및 ICC 분석에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증된 고품질 항체입니다. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA037668-100 Anti-LRCH4 Antibody, leucine-rich repeats and calponin homology (CH) domain containing 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037668-25 Anti-LRCH4 Antibody, leucine-rich repeats and calponin homology (CH) domain containing 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LRCH4 Antibody

Anti-LRCH4 Antibody

Target: leucine-rich repeats and calponin homology (CH) domain containing 4 (LRCH4)
Supplier: Atlas Antibodies


  • IHC (Orthogonal Validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human LRCH4.


Alternative Gene Names

LRN, LRRN1


Target Information

항목 내용
Target Protein leucine-rich repeats and calponin homology (CH) domain containing 4
Target Gene LRCH4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Homology Mouse ENSMUSG00000093445 (80%), Rat ENSRNOG00000001402 (79%)

Antigen Sequence:

LPIAGPATAPAPRPLGSIQRPNSFLFRSSSQSGSGPSSPDSVLRPRRYPQVPDEKDLMTQLRQVLESRLQ

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (Sodium Azide)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Datasheet

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.