
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-LRBA Antibody
상품 한눈에 보기
인간 LRBA 단백질에 대한 폴리클로날 항체로, IHC 및 ICC 등 다양한 응용에 적합함. Rabbit 유래 IgG 형태로 높은 특이성과 재현성을 제공. PrEST 항원을 이용해 친화 정제되어 신뢰성 높은 결과를 보장. Human에 검증된 반응성을 가짐.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA023597-100 Anti-LRBA Antibody, LPS-responsive vesicle trafficking, beach and anchor containing 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023597-25 Anti-LRBA Antibody, LPS-responsive vesicle trafficking, beach and anchor containing 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LRBA Antibody
Anti-LRBA Antibody
LPS-responsive vesicle trafficking, beach and anchor containing
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal Antibody against Human LRBA
Alternative Gene Names
- BGL
- CDC4L
- LAB300
- LBA
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | LPS-responsive vesicle trafficking, beach and anchor containing |
| Target Gene | LRBA |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000023453 (73%), Mouse ENSMUSG00000028080 (72%) |
Antigen Sequence:
SVLMVSKYRDILEPQNERHSQSCTETGSENENVSLSEITPAAFSTLTTASVEESESTSSARRRDSGIGEETATGLGSHVEVTPHTAPPGVSAGPDAISEVLSTLSLEVNKSPETKNDRGNDLDTKATPSVSV
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



