CacheBy
Atlas Antibodies Anti-LRBA Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LRBA Antibody

상품 한눈에 보기

인간 LRBA 단백질에 대한 폴리클로날 항체로, IHC 및 ICC 등 다양한 응용에 적합함. Rabbit 유래 IgG 형태로 높은 특이성과 재현성을 제공. PrEST 항원을 이용해 친화 정제되어 신뢰성 높은 결과를 보장. Human에 검증된 반응성을 가짐.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA023597-100 Anti-LRBA Antibody, LPS-responsive vesicle trafficking, beach and anchor containing 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023597-25 Anti-LRBA Antibody, LPS-responsive vesicle trafficking, beach and anchor containing 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LRBA Antibody

Anti-LRBA Antibody

LPS-responsive vesicle trafficking, beach and anchor containing


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human LRBA


Alternative Gene Names

  • BGL
  • CDC4L
  • LAB300
  • LBA

Open Datasheet


Target Information

항목 내용
Target Protein LPS-responsive vesicle trafficking, beach and anchor containing
Target Gene LRBA
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000023453 (73%), Mouse ENSMUSG00000028080 (72%)

Antigen Sequence:
SVLMVSKYRDILEPQNERHSQSCTETGSENENVSLSEITPAAFSTLTTASVEESESTSSARRRDSGIGEETATGLGSHVEVTPHTAPPGVSAGPDAISEVLSTLSLEVNKSPETKNDRGNDLDTKATPSVSV


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.