CacheBy
Atlas Antibodies Anti-LHX9 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LHX9 Antibody

상품 한눈에 보기

인간 LHX9 단백질을 인식하는 토끼 유래 폴리클로날 항체로, Western blot 등 다양한 연구용 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 반응 특이성과 안정적인 PBS-글리세롤 버퍼로 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA009695-100 Anti-LHX9 Antibody, LIM homeobox 9 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA009695-25 Anti-LHX9 Antibody, LIM homeobox 9 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LHX9 Antibody

Anti-LHX9 Antibody

제품 개요

  • Target Protein: LIM homeobox 9
  • Target Gene: LHX9
  • Antibody Type: Polyclonal Antibody against Human LHX9
  • Host: Rabbit
  • Isotype: IgG
  • Recommended Applications: Western Blot (WB)

Open Datasheet

Antigen Information

  • Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    GCRAEDNSCPFRPPAMLFHGISGGHIQGIMEEMERRSKTEARLAKGAQLNGRDAGMPPLSPEKPALCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLAL

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000019230 97%
Rat ENSRNOG00000010357 85%

Buffer Composition

Purification Method

Affinity purified using the PrEST antigen as affinity ligand.

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.