CacheBy
Atlas Antibodies Anti-LIAS Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LIAS Antibody

상품 한눈에 보기

Human LIAS 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC, WB, ICC 등 다양한 응용에 적합. Affinity purification 방식으로 높은 특이성과 재현성을 제공. Human, Mouse, Rat 종에 반응하며 안정적 PBS/glycerol buffer에 보존됨.

카탈로그번호
HPA019076-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA019076-100 Anti-LIAS Antibody, lipoic acid synthetase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019076-25 Anti-LIAS Antibody, lipoic acid synthetase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LIAS Antibody

Anti-LIAS Antibody

Target: Lipoic acid synthetase (LIAS)
Type: Rabbit Polyclonal Antibody
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human LIAS (Lipoic acid synthetase).

Alternative Gene Names

  • LAS

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Lipoic acid synthetase
Target Gene LIAS
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human, Mouse, Rat
Interspecies Identity Rat ENSRNOG00000002759 (92%), Mouse ENSMUSG00000029199 (89%)

Antigen Sequence:
SKVRDPRANFDQSLRVLKHAKKVQPDVISKTSIMLGLGENDEQVYATMKALREADVDCLTLGQYMQPTRRHLK


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야별 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

IHC
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.