CacheBy
Atlas Antibodies Anti-LHX4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LHX4 Antibody

상품 한눈에 보기

Human LHX4 단백질을 인식하는 Rabbit Polyclonal 항체로, ICC 등 다양한 응용에 적합함. PrEST 항원을 이용해 친화 정제되었으며, 높은 종 간 보존성을 가짐. PBS와 글리세롤 버퍼에 보존제로 sodium azide를 포함함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA055705-100 Anti-LHX4 Antibody, LIM homeobox 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055705-25 Anti-LHX4 Antibody, LIM homeobox 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LHX4 Antibody

Anti-LHX4 Antibody

Target Information

  • Target Protein: LIM homeobox 4
  • Target Gene: LHX4
  • Alternative Gene Name: Gsh4

면역세포화학(ICC) 등 다양한 연구용 응용에 적합합니다.

Product Description

  • Type: Polyclonal Antibody against Human LHX4
  • Host: Rabbit
  • Isotype: IgG
  • Purification Method: Affinity purified using the PrEST antigen as affinity ligand

Antigen Information

  • Antigen Sequence:
    QFYKSVKRSRGSSKQEKESSAEDCGVSDSELSFREDQILSELGHTNRIYGNVGDVTGGQLMNGSF
  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000026468) – 98%
  • Rat (ENSRNOG00000003595) – 98%

Buffer Composition

Component Description
Glycerol 40%
PBS pH 7.2
Sodium azide 0.02%, preservative

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.