
Atlas Antibodies Anti-LHX4 Antibody
상품 한눈에 보기
Human LHX4 단백질을 인식하는 Rabbit Polyclonal 항체로, ICC 등 다양한 응용에 적합함. PrEST 항원을 이용해 친화 정제되었으며, 높은 종 간 보존성을 가짐. PBS와 글리세롤 버퍼에 보존제로 sodium azide를 포함함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-LHX4 Antibody
Target Information
- Target Protein: LIM homeobox 4
- Target Gene: LHX4
- Alternative Gene Name: Gsh4
Recommended Applications
면역세포화학(ICC) 등 다양한 연구용 응용에 적합합니다.
Product Description
- Type: Polyclonal Antibody against Human LHX4
- Host: Rabbit
- Isotype: IgG
- Purification Method: Affinity purified using the PrEST antigen as affinity ligand
Antigen Information
- Antigen Sequence:
QFYKSVKRSRGSSKQEKESSAEDCGVSDSELSFREDQILSELGHTNRIYGNVGDVTGGQLMNGSF - Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000026468) – 98%
- Rat (ENSRNOG00000003595) – 98%
Buffer Composition
| Component | Description |
|---|---|
| Glycerol | 40% |
| PBS | pH 7.2 |
| Sodium azide | 0.02%, preservative |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
