CacheBy
Atlas Antibodies Anti-LIAS Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LIAS Antibody

상품 한눈에 보기

사람 LIAS 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 토끼 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 사람, 생쥐, 랫드에 반응합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA018842-100 Anti-LIAS Antibody, lipoic acid synthetase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018842-25 Anti-LIAS Antibody, lipoic acid synthetase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LIAS Antibody

Anti-LIAS Antibody

Target Protein: Lipoic acid synthetase
Target Gene: LIAS
Alternative Gene Name: LAS

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human LIAS (lipoic acid synthetase).

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

SKVRDPRANFDQSLRVLKHAKKVQPDVISKTSIMLGLGENDEQVYATMKALREADVDCLTLGQYMQPTRRHLK

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000002759 92%
Mouse ENSMUSG00000029199 89%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)
Open Datasheet (PDF)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.