Thermo Fisher Scientific Fetuin A Polyclonal Antibody
Fetuin A 단백질을 인식하는 Thermo Fisher Scientific의 토끼 폴리클로날 항체. Western blot, IHC, ICC, Flow cytometry, ELISA 등 다양한 응용에 적합. 항원 친화 크로마토그래피로 정제된 고순도 제품으로 연구용으로만 사용 가능.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific Fetuin A Polyclonal Antibody
Thermo Fisher Scientific Fetuin A Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC-P) | 0.5–1 µg/mL |
| Immunohistochemistry (Frozen) (IHC-F) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 0.5–1 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
| ELISA | 0.1–0.5 µg/mL |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to human Fetuin A (33–65aa DDPETEEAALVAIDYINQNLPWGYKHTLNQIDE) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745860 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Alpha2-HS glycoprotein (AHSG), also known as Fetuin A, is a serum glycoprotein synthesized by hepatocytes. It consists of two polypeptide chains derived from a single mRNA and is involved in endocytosis, brain development, and bone tissue formation. AHSG is found in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix, suggesting a role in tissue development, although its precise function remains unclear.
For Research Use Only. Not for use in diagnostic procedures or resale without authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.