Thermo Fisher Scientific Fetuin A Polyclonal Antibody
Fetuin A 단백질을 인식하는 Thermo Fisher Scientific의 토끼 폴리클로날 항체. Western blot, IHC, ICC, Flow cytometry, ELISA 등 다양한 응용에 적합. 항원 친화 크로마토그래피로 정제된 고순도 제품으로 연구용으로만 사용 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Thermo Fisher Scientific Fetuin A Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC-P) | 0.5–1 µg/mL |
| Immunohistochemistry (Frozen) (IHC-F) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 0.5–1 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
| ELISA | 0.1–0.5 µg/mL |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to human Fetuin A (33–65aa DDPETEEAALVAIDYINQNLPWGYKHTLNQIDE) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745860 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Alpha2-HS glycoprotein (AHSG), also known as Fetuin A, is a serum glycoprotein synthesized by hepatocytes. It consists of two polypeptide chains derived from a single mRNA and is involved in endocytosis, brain development, and bone tissue formation. AHSG is found in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix, suggesting a role in tissue development, although its precise function remains unclear.
For Research Use Only. Not for use in diagnostic procedures or resale without authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific AKAP2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Adenylate Kinase 1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Fetuin A Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific AIRE Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific AIMP2 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|