Thermo Fisher Scientific Adenylate Kinase 1 Polyclonal Antibody
Rabbit polyclonal antibody against human Adenylate Kinase 1 (AK1). Validated for Western blot at 0.1–0.5 µg/mL. Recognizes AK1 in human, mouse, and rat samples. Lyophilized form, reconstitutable to 500 µg/mL. For research use only.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
- Western Blot (WB): 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to a sequence at the C-terminus of human AK1 (149–189 aa: RLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTH) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745864 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Adenylate kinase is an enzyme that regulates adenine nucleotide composition within cells by catalyzing the reversible transfer of phosphate groups among adenine nucleotides.
Three isozymes have been identified in vertebrates: AK1, AK2, and AK3.
- AK1: Found in cytosol of skeletal muscle, brain, and erythrocytes
- AK2 / AK3: Found in mitochondria of tissues such as liver and heart
AK1 is associated with a rare genetic disorder causing nonspherocytic hemolytic anemia, where mutations in the AK1 gene reduce enzyme catalytic activity.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 파일: PA5-78748_Adenylate_Kinase_1_P00568-1_Rabbit.svg, PA5-78748_Adenylate_Kinase_1_P00568-1_Rabbit_PDP.jpeg)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific AKR1B1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific AKAP2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Adenylate Kinase 1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Fetuin A Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific AIRE Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|