CacheBy
Thermo Fisher Scientific Adenylate Kinase 1 Polyclonal Antibody
원본

Thermo Fisher Scientific Adenylate Kinase 1 Polyclonal Antibody

상품 한눈에 보기

Rabbit polyclonal antibody against human Adenylate Kinase 1 (AK1). Validated for Western blot at 0.1–0.5 µg/mL. Recognizes AK1 in human, mouse, and rat samples. Lyophilized form, reconstitutable to 500 µg/mL. For research use only.

카탈로그번호
PA578748
판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 01. 오후 06:55
Thermo Fisher Scientific PA578748 Adenylate Kinase 1 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific Adenylate Kinase 1 Polyclonal Antibody

Applications

  • Western Blot (WB): 0.1–0.5 µg/mL

Product Specifications

항목 내용
Species Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen Synthetic peptide corresponding to a sequence at the C-terminus of human AK1 (149–189 aa: RLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTH)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS with 5 mg BSA
Contains 0.05 mg sodium azide
Storage Conditions −20°C
Shipping Conditions Ambient (domestic); Wet ice (international)
RRID AB_2745864

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

Adenylate kinase is an enzyme that regulates adenine nucleotide composition within cells by catalyzing the reversible transfer of phosphate groups among adenine nucleotides.
Three isozymes have been identified in vertebrates: AK1, AK2, and AK3.

  • AK1: Found in cytosol of skeletal muscle, brain, and erythrocytes
  • AK2 / AK3: Found in mitochondria of tissues such as liver and heart

AK1 is associated with a rare genetic disorder causing nonspherocytic hemolytic anemia, where mutations in the AK1 gene reduce enzyme catalytic activity.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

제품 이미지

(이미지 파일: PA5-78748_Adenylate_Kinase_1_P00568-1_Rabbit.svg, PA5-78748_Adenylate_Kinase_1_P00568-1_Rabbit_PDP.jpeg)

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.