Thermo Fisher Scientific Adenylate Kinase 1 Polyclonal Antibody
Rabbit polyclonal antibody against human Adenylate Kinase 1 (AK1). Validated for Western blot at 0.1–0.5 µg/mL. Recognizes AK1 in human, mouse, and rat samples. Lyophilized form, reconstitutable to 500 µg/mL. For research use only.
- 카탈로그번호
- PA578748
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific Adenylate Kinase 1 Polyclonal Antibody
Applications
- Western Blot (WB): 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to a sequence at the C-terminus of human AK1 (149–189 aa: RLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTH) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745864 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Adenylate kinase is an enzyme that regulates adenine nucleotide composition within cells by catalyzing the reversible transfer of phosphate groups among adenine nucleotides.
Three isozymes have been identified in vertebrates: AK1, AK2, and AK3.
- AK1: Found in cytosol of skeletal muscle, brain, and erythrocytes
- AK2 / AK3: Found in mitochondria of tissues such as liver and heart
AK1 is associated with a rare genetic disorder causing nonspherocytic hemolytic anemia, where mutations in the AK1 gene reduce enzyme catalytic activity.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 파일: PA5-78748_Adenylate_Kinase_1_P00568-1_Rabbit.svg, PA5-78748_Adenylate_Kinase_1_P00568-1_Rabbit_PDP.jpeg)
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.