원본
Thermo Fisher Scientific AKAP2 Polyclonal Antibody
상품 한눈에 보기
AKAP2 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot에 적합합니다. Human과 Rat 시료에 반응하며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며, 재구성 후 500 µg/mL 농도로 사용 가능합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오전 06:50
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA578749 AKAP2 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific AKAP2 Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human AKAP2 (813–852aa ETHKSKRRERMDDSSVLEATRVNRRKSALALRWEAGIYAN). |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | -20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745865 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Binds to the regulatory subunit (RII) of protein kinase A. May be involved in establishing polarity in signaling systems or in integrating PKA-RII isoforms with downstream effectors to capture, amplify, and focus diffuse, trans-cellular signals carried by cAMP. [UniProt]
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific AKR1C1/AKR1C2 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific AKR1B1 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific Adenylate Kinase 1 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific Fetuin A Polyclonal Antibody568,000원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.