Thermo Fisher Scientific TAP1 Polyclonal Antibody
인간 TAP1 단백질을 인식하는 Rabbit Polyclonal 항체로 Western blot과 IHC(Paraffin)에 적합합니다. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공됩니다. 재구성 후 500 µg/mL 농도이며 연구용으로만 사용됩니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific TAP1 Polyclonal Antibody
Thermo Fisher Scientific TAP1 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to human TAP1 (438–471aa: RSFANEEGEAQKFREKLQEIKTLNQKEAVAYAVN) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747209 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The membrane-associated protein encoded by this gene belongs to the ATP-binding cassette (ABC) transporter superfamily. These proteins transport various molecules across cellular membranes and are divided into seven subfamilies: ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White. TAP1 is part of the MDR/TAP subfamily, involved in multidrug resistance and peptide transport into the endoplasmic reticulum for class I molecule assembly. Mutations in TAP1 may be linked to ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.