Thermo Fisher Scientific TAP1 Polyclonal Antibody
인간 TAP1 단백질을 인식하는 Rabbit Polyclonal 항체로 Western blot과 IHC(Paraffin)에 적합합니다. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공됩니다. 재구성 후 500 µg/mL 농도이며 연구용으로만 사용됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Thermo Fisher Scientific TAP1 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to human TAP1 (438–471aa: RSFANEEGEAQKFREKLQEIKTLNQKEAVAYAVN) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747209 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The membrane-associated protein encoded by this gene belongs to the ATP-binding cassette (ABC) transporter superfamily. These proteins transport various molecules across cellular membranes and are divided into seven subfamilies: ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White. TAP1 is part of the MDR/TAP subfamily, involved in multidrug resistance and peptide transport into the endoplasmic reticulum for class I molecule assembly. Mutations in TAP1 may be linked to ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific TCP1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific TCF7L1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific TAP1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific TBP Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific TAT Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|