
Thermo Fisher Scientific JAK1 Polyclonal Antibody
JAK1 단백질을 인식하는 Rabbit Polyclonal 항체로 Western blot에 적합. Human, Mouse, Rat에 반응하며 항원 친화 크로마토그래피로 정제됨. 동결건조 형태로 제공되며 -20°C에서 보관. 연구용으로만 사용 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human JAK1 (78–115aa FALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTN) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | No preservative |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746661 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Janus kinase 1 (JAK1) is a protein tyrosine kinase involved in interferon-α/β and -γ signal transduction pathways. Upon stimulation by interferons and cytokines, JAK1 recruits Stat transcription factors to cytokine receptor complexes, leading to phosphorylation, dimerization, and nuclear translocation of Stat proteins. These activated Stat dimers regulate transcription of target genes. Phosphorylation at tyrosine residues 1022 and 1023 is critical for JAK1 catalytic activation.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific ITLN1 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific ITPR3 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific JAK1 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific CD104 (Integrin beta 4) Polyclonal Antibody
668,200원

Thermo Fisher Scientific
Thermo Fisher Scientific CD11b Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|