Thermo Fisher Scientific JAK1 Polyclonal Antibody
JAK1 단백질을 인식하는 Rabbit Polyclonal 항체로 Western blot에 적합. Human, Mouse, Rat에 반응하며 항원 친화 크로마토그래피로 정제됨. 동결건조 형태로 제공되며 -20°C에서 보관. 연구용으로만 사용 가능.
- 카탈로그번호
- PA579546
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific JAK1 Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human JAK1 (78–115aa FALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTN) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | No preservative |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746661 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Janus kinase 1 (JAK1) is a protein tyrosine kinase involved in interferon-α/β and -γ signal transduction pathways. Upon stimulation by interferons and cytokines, JAK1 recruits Stat transcription factors to cytokine receptor complexes, leading to phosphorylation, dimerization, and nuclear translocation of Stat proteins. These activated Stat dimers regulate transcription of target genes. Phosphorylation at tyrosine residues 1022 and 1023 is critical for JAK1 catalytic activation.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.