원본
Thermo Fisher Scientific ITLN1 Polyclonal Antibody
상품 한눈에 보기
Human ITLN1 단백질을 인식하는 Rabbit Polyclonal Antibody로, WB, IHC, ICC/IF에 사용 가능. 항원 친화 크로마토그래피로 정제된 고순도 항체. 인슐린 자극 포도당 흡수 및 미생물 방어 관련 연구에 적합. 연구용으로만 사용.
- 카탈로그번호
- PA579543
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오전 06:01
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA579543 ITLN1 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific ITLN1 Polyclonal Antibody
Applications
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human |
| Host/Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human ITLN1 (19–59aa TDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLR) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | -20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746658 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
ITLN1은 기저 포도당 흡수에는 영향을 주지 않지만, 지방세포에서 인슐린 자극 포도당 흡수를 증가시킵니다. 인슐린 유무에 관계없이 AKT 인산화를 촉진하며, 미생물에 대한 방어 시스템에 관여할 수 있습니다. 또한 병원체의 탄수화물 사슬 및 갈락토푸라노실 잔기를 포함하는 세균 성분을 칼슘 의존적으로 인식할 수 있습니다. 철 대사에도 관련될 수 있습니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific GCN5 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific KV1.4 (KCNA4) Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific ITPR3 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific JAK1 Polyclonal Antibody568,000원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.