Thermo Fisher Scientific ASCL1 Monoclonal Antibody (3D3)
ASCL1 단백질을 표적하는 마우스 모노클로날 항체로, Western blot과 ELISA에 적합합니다. 인간 시료에 반응하며, 고순도의 친화 크로마토그래피 정제 제품입니다. 신경계 발달 연구 및 신경내분비 종양 마커 연구에 활용 가능합니다.
- 카탈로그번호
- H00000429-M03
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific ASCL1 Monoclonal Antibody (3D3)
Applications
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1–5 µg/mL |
| ELISA | 1 ng/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Mouse / IgG2a, kappa |
| Class | Monoclonal |
| Type | Antibody |
| Clone | 3D3 |
| Immunogen | ASCL1 (NP_004307, 137–236 a.a.) partial recombinant protein with GST tag (GST tag MW: 26 kDa) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | See Label |
| Purification | Affinity chromatography |
| Storage buffer | PBS, pH 7.4 |
| Contains | No preservative |
| Storage conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
Product Specific Information
Sequence of this protein is as follows:
GFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNWF
Target Information
ASCL1 (also known as ASH1) is a basic helix-loop-helix transcription factor required for early nervous system development. It is expressed in fetal brain and is essential for proper autonomic neuron development and survival. ASCL1 interaction with MEF-2A may regulate gene expression critical for neuronal circuit formation in the central nervous system.
High ASCL1 expression in neuroendocrine tumors (e.g., medullary thyroid cancer, small cell lung cancer, and other lung cancers with neuroendocrine features) makes it a useful marker for such cancers.
The ASCL1 gene maps to human chromosome 12 and contains a trinucleotide repeat region, making it a candidate locus for inherited diseases.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.