Atlas Antibodies Anti-ADAMTS7 Antibody
상품 옵션 정보 | ||||||
---|---|---|---|---|---|---|
카탈로그 번호 | 설명 | 상태 | 단위 | 가격 | 가격(VAT포함) | 수량 / 장바구니 |
HPA048453-100 | Atlas Antibodies HPA048453-100 Anti-ADAMTS7 Antibody, ADAM metallopeptidase with thrombospondin type 1 motif, 7 100ul | 재고문의 | 100ul | 728,000원 | 800,800원 | |
HPA048453-25 | Atlas Antibodies HPA048453-25 Anti-ADAMTS7 Antibody, ADAM metallopeptidase with thrombospondin type 1 motif, 7 25ul | 재고문의 | 25ul | 528,000원 | 580,800원 |
다른 상품 둘러보기
Anti-ADAMTS7 Antibody
ADAM metallopeptidase with thrombospondin type 1 motif, 7
Recommended Applications
Product Description
Polyclonal Antibody against Human ADAMTS7
Alternative Gene Names
ADAM-TS7, DKFZp434H204
Target Protein
ADAM metallopeptidase with thrombospondin type 1 motif, 7
Target Gene
ADAMTS7
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
LGRAHIRAHTPACHLLGEVQDSELEGGLAAISACDGLKGVFLLSN
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Mouse ENSMUSG00000032363 (76%)
Rat ENSRNOG00000028036 (71%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet
)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|