
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ADAMTS5 Antibody
상품 한눈에 보기
인간 ADAMTS5 단백질을 표적으로 하는 토끼 폴리클로날 항체입니다. 면역조직화학(IHC) 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. 높은 종 간 반응성(인간, 마우스, 랫드) 확인됨. 안정적인 PBS/glycerol 버퍼에 보존제 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA005661-100 Anti-ADAMTS5 Antibody, ADAM metallopeptidase with thrombospondin type 1 motif, 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA005661-25 Anti-ADAMTS5 Antibody, ADAM metallopeptidase with thrombospondin type 1 motif, 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ADAMTS5 Antibody
Anti-ADAMTS5 Antibody
Target: ADAM metallopeptidase with thrombospondin type 1 motif, 5
Supplier: Atlas Antibodies
Recommended Applications
면역조직화학 (IHC)
Product Description
Polyclonal Antibody against Human ADAMTS5
Alternative Gene Names
ADAMTS11, ADMP-2
Target Information
- Target Protein: ADAM metallopeptidase with thrombospondin type 1 motif, 5
- Target Gene: ADAMTS5
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence:
KGLVQNIDQLYSGGGKVGYLVYAGGRRFLLDLERDGSVGIAGFVPAGGGTSAPWRHRSHCFYRGTVDGSPRSLAVFDLCGGLDGFFAVKHARYTLKPLLRGPWAEEEKGRVYGDGS
Verified Species Reactivity
Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000022894 | 85% |
| Rat | ENSRNOG00000057794 | 84% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
Material Safety Data Sheet (Sodium Azide)
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



