CacheBy
Atlas Antibodies Anti-ADAMTS5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ADAMTS5 Antibody

상품 한눈에 보기

인간 ADAMTS5 단백질을 표적으로 하는 토끼 폴리클로날 항체입니다. 면역조직화학(IHC) 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. 높은 종 간 반응성(인간, 마우스, 랫드) 확인됨. 안정적인 PBS/glycerol 버퍼에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA005661-100 Anti-ADAMTS5 Antibody, ADAM metallopeptidase with thrombospondin type 1 motif, 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA005661-25 Anti-ADAMTS5 Antibody, ADAM metallopeptidase with thrombospondin type 1 motif, 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ADAMTS5 Antibody

Anti-ADAMTS5 Antibody

Target: ADAM metallopeptidase with thrombospondin type 1 motif, 5
Supplier: Atlas Antibodies


면역조직화학 (IHC)


Product Description

Polyclonal Antibody against Human ADAMTS5


Alternative Gene Names

ADAMTS11, ADMP-2

Open Datasheet


Target Information

  • Target Protein: ADAM metallopeptidase with thrombospondin type 1 motif, 5
  • Target Gene: ADAMTS5
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Epitope Sequence:
KGLVQNIDQLYSGGGKVGYLVYAGGRRFLLDLERDGSVGIAGFVPAGGGTSAPWRHRSHCFYRGTVDGSPRSLAVFDLCGGLDGFFAVKHARYTLKPLLRGPWAEEEKGRVYGDGS


Verified Species Reactivity

Human


Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000022894 85%
Rat ENSRNOG00000057794 84%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen

Material Safety Data Sheet (Sodium Azide)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.