
원본
Atlas Antibodies Anti-ADAMTS5 Antibody
상품 한눈에 보기
인간 ADAMTS5 단백질을 인식하는 폴리클로날 항체로, 토끼에서 유래하였으며 IgG 아이소타입입니다. IHC 등 다양한 응용에 적합하며, 프레스티지 항원으로 친화 정제되었습니다. 40% 글리세롤과 PBS 완충액에 보존되어 안정적입니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA030908-100 Anti-ADAMTS5 Antibody, ADAM metallopeptidase with thrombospondin type 1 motif, 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030908-25 Anti-ADAMTS5 Antibody, ADAM metallopeptidase with thrombospondin type 1 motif, 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ADAMTS5 Antibody
Anti-ADAMTS5 Antibody
ADAM metallopeptidase with thrombospondin type 1 motif, 5
Recommended Applications
면역조직화학(IHC) 등 다양한 응용에 적합
Product Description
Polyclonal antibody against human ADAMTS5.
Alternative Gene Names
ADAMTS11, ADMP-2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ADAM metallopeptidase with thrombospondin type 1 motif, 5 |
| Target Gene | ADAMTS5 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | KGLVQNIDQLYSGGGKVGYLVYAGGRRFLLDLERDGSVGIAGFVPAGGGTSAPWRHRSHCFYRGTVDGSPRSLAVFDLCGGLDGFFAVKHARYTLKPLLRGPWAEEEKGRVYGDGS |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000022894 (85%), Rat ENSRNOG00000057794 (84%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자가 실험 목적에 맞게 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



