Atlas Antibodies Anti-ADAMTS7 Antibody

상품 한눈에 보기

Human ADAMTS7 단백질을 인식하는 폴리클로날 항체로, IHC 등 다양한 응용에 적합합니다. Rabbit 호스트에서 생산되었으며, PrEST 항원으로 정제된 고순도 IgG입니다. Human에 대한 반응성이 검증되어 신뢰성 높은 연구용 시약입니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA045284-100 Anti-ADAMTS7 Antibody, ADAM metallopeptidase with thrombospondin type 1 motif, 7 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA045284-25 Anti-ADAMTS7 Antibody, ADAM metallopeptidase with thrombospondin type 1 motif, 7 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: ADAM metallopeptidase with thrombospondin type 1 motif, 7
Supplier: Atlas Antibodies

면역조직화학(IHC) 등 다양한 연구 응용에 적합

Polyclonal antibody against human ADAMTS7.

ADAM-TS7, DKFZp434H204

항목	내용
Target Protein	ADAM metallopeptidase with thrombospondin type 1 motif, 7
Target Gene	ADAMTS7
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000032363 (76%), Rat ENSRNOG00000028036 (71%)

Antigen Sequence:
LGRAHIRAHTPACHLLGEVQDSELEGGLAAISACDGLKGVFLLSN

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
MSDS	Material Safety Data Sheet