Atlas Antibodies Anti-AAMDC Antibody
상품 한눈에 보기
인간 AAMDC 단백질을 표적으로 하는 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. 독립 항체 비교 및 재조합 발현 검증으로 신뢰성 향상. 토끼 유래 IgG 형식으로 높은 특이성과 순도를 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-AAMDC Antibody
adipogenesis associated, Mth938 domain containing
Recommended Applications
IHC (Independent Validation)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.WB (Recombinant Expression Validation)
Recombinant expression validation in WB using target protein overexpression.ICC
Suitable for immunocytochemistry applications.
Product Description
Polyclonal Antibody against Human AAMDC
Alternative Gene Names
C11orf67, CK067, FLJ21035, PTD015
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | adipogenesis associated, Mth938 domain containing |
| Target Gene | AAMDC |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | EIASLSWGQMKVKGSNTTYKDCKVWPGGSRTWDWRETGTEHSPGVQPADVKEVVEK |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000035642 (89%), Rat ENSRNOG00000012584 (89%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.