
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-AAMDC Antibody
상품 한눈에 보기
인간 AAMDC 단백질을 표적으로 하는 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. 독립 항체 비교 및 재조합 발현 검증으로 신뢰성 향상. 토끼 유래 IgG 형식으로 높은 특이성과 순도를 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA037919-100 Anti-AAMDC Antibody, adipogenesis associated, Mth938 domain containing 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037919-25 Anti-AAMDC Antibody, adipogenesis associated, Mth938 domain containing 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-AAMDC Antibody
Anti-AAMDC Antibody
adipogenesis associated, Mth938 domain containing
Recommended Applications
IHC (Independent Validation)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.WB (Recombinant Expression Validation)
Recombinant expression validation in WB using target protein overexpression.ICC
Suitable for immunocytochemistry applications.
Product Description
Polyclonal Antibody against Human AAMDC
Alternative Gene Names
C11orf67, CK067, FLJ21035, PTD015
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | adipogenesis associated, Mth938 domain containing |
| Target Gene | AAMDC |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | EIASLSWGQMKVKGSNTTYKDCKVWPGGSRTWDWRETGTEHSPGVQPADVKEVVEK |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000035642 (89%), Rat ENSRNOG00000012584 (89%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



