CacheBy
Atlas Antibodies Anti-AAMP Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-AAMP Antibody

상품 한눈에 보기

Human AAMP 단백질을 인식하는 토끼 유래 폴리클로날 항체로, PrEST 항원으로 친화 정제됨. 면역세포 이동 관련 단백질 연구에 적합하며 인체 반응성이 검증됨. 다양한 응용에 사용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA031868-100 Anti-AAMP Antibody, angio-associated, migratory cell protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031868-25 Anti-AAMP Antibody, angio-associated, migratory cell protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-AAMP Antibody

Anti-AAMP Antibody

Target Information

  • Target Protein: Angio-associated, migratory cell protein
  • Target Gene: AAMP
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
RIWDLKQGSPIHVLKGTEGHQGPLTCVAANQDGSLILTGSVDCQAKLVSATTGKVVGVFRPETVASQPSLGEGEESESNSVESLGFCSVMP

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000014399 98%
Mouse ENSMUSG00000006299 98%

Product Description

Polyclonal Antibody against Human AAMP
Open Datasheet

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

ICC (Immunocytochemistry)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.