CacheBy
Atlas Antibodies Anti-AANAT Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-AANAT Antibody

상품 한눈에 보기

Human AANAT 단백질을 인식하는 Rabbit Polyclonal 항체로, 면역형광 등 다양한 응용에 적합. PrEST 항원을 이용해 친화정제되었으며, Human에 대한 반응성이 검증됨. 40% glycerol 기반 PBS buffer에 보존제로 sodium azide 포함.

카탈로그번호
HPA054321-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA054321-100 Anti-AANAT Antibody, aralkylamine N-acetyltransferase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054321-25 Anti-AANAT Antibody, aralkylamine N-acetyltransferase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-AANAT Antibody

Anti-AANAT Antibody

Target: aralkylamine N-acetyltransferase (AANAT)
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human aralkylamine N-acetyltransferase (AANAT).


Alternative Gene Names

  • SNAT

Open Datasheet


Target Information

항목 내용
Target Protein aralkylamine N-acetyltransferase
Target Gene AANAT
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000020804 (89%)
Rat ENSRNOG00000011182 (89%)

Antigen Sequence:

FLTLCPELSLGWFEEGCLVAFIIGSLWDKERLMQESLTLHRSGGHIAHLHVLAVHRAFRQQGRGPILLWR

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.