
Atlas Antibodies Anti-AAMDC Antibody
Human AAMDC 단백질을 표적으로 하는 Rabbit Polyclonal 항체로, IHC, WB, ICC 등 다양한 응용에 적합. 독립 항체 비교 및 재조합 발현 검증으로 신뢰성 확보. PrEST 항원 기반 친화정제 방식으로 높은 특이도와 재현성 제공.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-AAMDC Antibody
adipogenesis associated, Mth938 domain containing
Recommended Applications
IHC (Independent Antibody Validation)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.WB (Recombinant Expression Validation)
Recombinant expression validation in WB using target protein overexpression.ICC
Product Description
Polyclonal Antibody against Human AAMDC
Alternative Gene Names
C11orf67, CK067, FLJ21035, PTD015
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | adipogenesis associated, Mth938 domain containing |
| Target Gene | AAMDC |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | EIASLSWGQMKVKGSNTTYKDCKVWPGGSRTWDWRETGTEHSPGVQPADVKEVVEK |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000012584 (89%), Mouse ENSMUSG00000035642 (89%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-AAMDC Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-AAK1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-AAMDC Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-AADACL4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-AAGAB Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|