
Thermo Fisher Scientific GAD65 Polyclonal Antibody
GAD65 단백질을 표적으로 하는 Rabbit Polyclonal Antibody로, 인간·마우스·랫트 반응성 확인됨. Western blot 및 IHC(P)에서 사용 가능. 항원 친화 크로마토그래피로 정제되어 높은 특이성과 재현성 제공. 자가면역 질환 연구용으로 적합.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human GAD65 (131–164aa KVIDFHYPNELLQEYNWELADQPQNLEEILMHCQ) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746409 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
GAD65 (glutamic acid decarboxylase-65)는 인슐린 의존성 제1형 당뇨병(IDDM), stiff man syndrome, 다발성 내분비 자가면역 질환 등 자가면역 질환에서 발견됩니다.
자가항체는 새로 진단된 IDDM 환자의 약 60–70%에서 검출되며, 질병 활성의 중요한 마커로 사용됩니다. 대부분 GAD65의 입체 구조 의존적 영역을 인식하며, GAD67에는 거의 결합하지 않습니다. GAD67에 대한 자가항체는 최근 발병한 IDDM 환자의 약 15%에서만 발견되며, 대부분 GAD65에 의해 차단됩니다. 이는 두 이소형 간의 공통 에피토프 존재를 시사합니다.
For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific PLM Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific GADD45G Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific GAD65 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific GAA Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific FZD3 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|