CacheBy
Thermo Fisher Scientific FZD3 Polyclonal Antibody
원본

Thermo Fisher Scientific FZD3 Polyclonal Antibody

상품 한눈에 보기

FZD3 단백질을 인식하는 Thermo Fisher의 Rabbit Polyclonal Antibody로, WB 및 IHC(P)에서 검증됨. Human, Mouse, Rat 반응성. 항원 친화 크로마토그래피로 정제된 동결건조 형태이며, 재구성 시 500 µg/mL 농도. 연구용으로만 사용 가능.

카탈로그번호
PA579289
판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오후 09:23
Thermo Fisher Scientific PA579289 FZD3 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific FZD3 Polyclonal Antibody

Applications

Western Blot (WB)

  • Tested Dilution: 0.1–0.5 µg/mL

Immunohistochemistry (Paraffin) (IHC (P))

  • Tested Dilution: 0.5–1 µg/mL

Product Specifications

항목 내용
Species Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence of human FZD3 (MPNLLNHYDQQTAALAMEPFHPMVNLDCSRDFRPFL)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS with 4 mg trehalose
Contains 0.05 mg sodium azide
Storage Conditions -20°C
Shipping Conditions Wet ice
RRID AB_2746405

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. The function of this protein is unknown, although it may play a role in mammalian hair follicle development.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.