Thermo Fisher Scientific FZD3 Polyclonal Antibody
FZD3 단백질을 인식하는 Thermo Fisher의 Rabbit Polyclonal Antibody로, WB 및 IHC(P)에서 검증됨. Human, Mouse, Rat 반응성. 항원 친화 크로마토그래피로 정제된 동결건조 형태이며, 재구성 시 500 µg/mL 농도. 연구용으로만 사용 가능.
- 카탈로그번호
- PA579289
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific FZD3 Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P))
- Tested Dilution: 0.5–1 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human FZD3 (MPNLLNHYDQQTAALAMEPFHPMVNLDCSRDFRPFL) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746405 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. The function of this protein is unknown, although it may play a role in mammalian hair follicle development.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.