CacheBy
Thermo Fisher Scientific GAA Polyclonal Antibody
원본

Thermo Fisher Scientific GAA Polyclonal Antibody

상품 한눈에 보기

Thermo Fisher Scientific의 GAA Polyclonal Antibody는 인간 GAA 단백질을 인식하는 토끼 유래 IgG 항체입니다. Western blot 및 IHC(P)에서 검증되었으며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며 -20°C 보관이 권장됩니다.

카탈로그번호
PA579290
판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오후 05:55
Thermo Fisher Scientific PA579290 GAA Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific GAA Polyclonal Antibody

Applications and Tested Dilution

Application Tested Dilution
Western Blot (WB) 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P)) 0.5–1 µg/mL

Product Specifications

항목 내용
Species Reactivity Human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human GAA (494–527aa, TALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIR)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS with 4 mg trehalose
Contains 0.05 mg sodium azide
Storage Conditions -20°C
Shipping Conditions Wet ice
RRID AB_2746406

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

This gene encodes acid alpha-glucosidase, which is essential for the degradation of glycogen to glucose in lysosomes. Different forms of acid alpha-glucosidase are obtained by proteolytic processing.
Defects in this gene cause glycogen storage disease II (Pompe’s disease), an autosomal recessive disorder with a broad clinical spectrum.
Three transcript variants encoding the same protein have been identified for this gene.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.