CacheBy
Thermo Fisher Scientific MMP8 Polyclonal Antibody
원본

Thermo Fisher Scientific MMP8 Polyclonal Antibody

상품 한눈에 보기

Thermo Fisher Scientific의 MMP8 Polyclonal Antibody는 Mouse와 Rat에 반응하며, WB, IHC, ELISA 등 다양한 응용에 적합합니다. Rabbit IgG 기반으로 항원 친화 크로마토그래피로 정제되었습니다. Lyophilized 형태로 제공되며, 연구용으로만 사용 가능합니다.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 02. 오후 09:53
Thermo Fisher Scientific PA579687 MMP8 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific MMP8 Polyclonal Antibody

Applications

Application Tested Dilution Publications
Western Blot (WB) 0.1–0.5 µg/mL View 1 publication
Immunohistochemistry (IHC) View 1 publication
Immunohistochemistry (Paraffin) (IHC (P)) 0.5–1 µg/mL View publication
Immunocytochemistry (ICC/IF) View 1 publication
ELISA 0.1–0.5 µg/mL View publication

Product Specifications

Specification Description
Species Reactivity Mouse, Rat
Published Species Mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of mouse MMP-8 (120–157 aa: HTPQLSRAEVKTAIEKAFHVWSVASPLTFTEILQGEAD)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS with 5 mg BSA
Contains 0.05 mg sodium azide
Storage Conditions −20°C
Shipping Conditions Ambient (domestic); Wet ice (international)
RRID AB_2746802

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

Can degrade fibrillar type I, II, and III collagens.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

제품 이미지

(이미지 없음)

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.