원본
Thermo Fisher Scientific MMP8 Polyclonal Antibody
상품 한눈에 보기
Thermo Fisher Scientific의 MMP8 Polyclonal Antibody는 Mouse와 Rat에 반응하며, WB, IHC, ELISA 등 다양한 응용에 적합합니다. Rabbit IgG 기반으로 항원 친화 크로마토그래피로 정제되었습니다. Lyophilized 형태로 제공되며, 연구용으로만 사용 가능합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 02. 오후 09:53
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA579687 MMP8 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific MMP8 Polyclonal Antibody
Applications
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL | View 1 publication |
| Immunohistochemistry (IHC) | – | View 1 publication |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL | View publication |
| Immunocytochemistry (ICC/IF) | – | View 1 publication |
| ELISA | 0.1–0.5 µg/mL | View publication |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Mouse, Rat |
| Published Species | Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of mouse MMP-8 (120–157 aa: HTPQLSRAEVKTAIEKAFHVWSVASPLTFTEILQGEAD) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746802 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Can degrade fibrillar type I, II, and III collagens.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific MNAT1 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific MPG Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific MMP9 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific MMP9 Polyclonal Antibody568,000원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.