Thermo Fisher Scientific MMP8 Polyclonal Antibody
상품 한눈에 보기
Thermo Fisher Scientific의 MMP8 Polyclonal Antibody는 Mouse와 Rat에 반응하며, WB, IHC, ELISA 등 다양한 응용에 적합합니다. Rabbit IgG 기반으로 항원 친화 크로마토그래피로 정제되었습니다. Lyophilized 형태로 제공되며, 연구용으로만 사용 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL | View 1 publication |
| Immunohistochemistry (IHC) | – | View 1 publication |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL | View publication |
| Immunocytochemistry (ICC/IF) | – | View 1 publication |
| ELISA | 0.1–0.5 µg/mL | View publication |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Mouse, Rat |
| Published Species | Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of mouse MMP-8 (120–157 aa: HTPQLSRAEVKTAIEKAFHVWSVASPLTFTEILQGEAD) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746802 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Can degrade fibrillar type I, II, and III collagens.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific MNAT1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific MPG Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific MMP8 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific MMP9 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific MMP9 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.