Thermo Fisher Scientific MMP9 Polyclonal Antibody
Thermo Fisher Scientific의 MMP9 Polyclonal Antibody는 Mouse 및 Rat 시료에 반응하는 Rabbit IgG 기반 항체입니다. Western blot과 IHC(P) 실험에 적합하며, 항원 친화 크로마토그래피로 정제되었습니다. 조직 재형성 및 염증 반응 연구에 활용됩니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific MMP9 Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P))
- Tested Dilution: 0.5–1 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of rat MMP-9 (622–658aa RRGGKALLISRERIWKFDLKSQKVDPQSVTRLDNEFS) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746803 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
MMP9 (matrix metallopeptidase 9, GELB, CLG4B)는 아연 및 칼슘 의존성 엔도펩티다아제 계열의 단백질로, 세포외 기질 단백질을 분해합니다.
92 kDa의 zymogen 형태로 분비되며, 활성화 시 82 kDa 효소로 전환됩니다.
MMP9은 단핵구, 대식세포, 호중구, 각질형성세포, 섬유아세포, 파골세포, 내피세포 등 다양한 세포에서 발현되며, 염증 반응, 조직 재형성, 상처 치유, 종양 성장 및 전이에 관여합니다.
또한 Type IV 및 V collagen을 분해하며, IL-8에 의해 유도된 조혈모세포 이동 및 종양 관련 조직 재형성에도 역할을 합니다.
높은 MMP9 발현은 특발성 심방세동 및 대동맥류 진행과 관련이 있음이 보고되었습니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.