
원본
Thermo Fisher Scientific MMP9 Polyclonal Antibody
상품 한눈에 보기
Thermo Fisher Scientific의 MMP9 Polyclonal Antibody는 Mouse와 Rat 시료에 반응하며, WB, IHC(P), ELISA에 사용 가능합니다. Rabbit에서 유래한 IgG 폴리클로날 항체로, 항원 친화 크로마토그래피로 정제되었습니다. PBS/BSA 완충액에 동결건조 형태로 제공되며, -20°C에서 보관합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오전 04:10
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA579689 MMP9 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific MMP9 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| ELISA | 0.1–0.5 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to a sequence at the C-terminus of mouse MMP-9 (641–672aa, KALLFSKGRVWRFDLKSQKVDPQSVIRVDKEF) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746804 |
Product Specific Information
- Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
MMP9 (matrix metallopeptidase 9, GELB, CLG4B)는 아연 및 칼슘 의존성 엔도펩티다아제 계열의 단백질로, 세포외 기질 단백질을 분해합니다. 92 kDa 전구체 형태로 분비되며, 활성화 시 82 kDa 효소로 절단됩니다.
MMP9는 섬유아세포, 대식세포, 중성구, 각질형성세포 등 다양한 세포에서 발현되어 염증 반응, 조직 재형성, 상처 치유, 종양 성장 및 전이에 관여합니다. 또한 type IV 및 V 콜라겐을 분해하며, 골수 유래 세포에서 공급되어 피부암 발생에도 기여합니다.
연구 결과, MMP9의 증가가 특발성 심방세동 및 대동맥류 진행과 관련이 있음이 보고되었습니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
