CacheBy
Thermo Fisher Scientific MMP9 Polyclonal Antibody
원본

Thermo Fisher Scientific MMP9 Polyclonal Antibody

상품 한눈에 보기

Thermo Fisher Scientific의 MMP9 Polyclonal Antibody는 Mouse와 Rat 시료에 반응하며, WB, IHC(P), ELISA에 사용 가능합니다. Rabbit에서 유래한 IgG 폴리클로날 항체로, 항원 친화 크로마토그래피로 정제되었습니다. PBS/BSA 완충액에 동결건조 형태로 제공되며, -20°C에서 보관합니다.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오전 04:10
Thermo Fisher Scientific PA579689 MMP9 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific MMP9 Polyclonal Antibody

Applications and Tested Dilution

Application Tested Dilution
Western Blot (WB) 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P)) 0.5–1 µg/mL
ELISA 0.1–0.5 µg/mL

Product Specifications

항목 내용
Species Reactivity Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen Synthetic peptide corresponding to a sequence at the C-terminus of mouse MMP-9 (641–672aa, KALLFSKGRVWRFDLKSQKVDPQSVIRVDKEF)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS with 5 mg BSA
Contains 0.05 mg sodium azide
Storage Conditions -20°C
Shipping Conditions Ambient (domestic); Wet ice (international)
RRID AB_2746804

Product Specific Information

  • Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

MMP9 (matrix metallopeptidase 9, GELB, CLG4B)는 아연 및 칼슘 의존성 엔도펩티다아제 계열의 단백질로, 세포외 기질 단백질을 분해합니다. 92 kDa 전구체 형태로 분비되며, 활성화 시 82 kDa 효소로 절단됩니다.
MMP9는 섬유아세포, 대식세포, 중성구, 각질형성세포 등 다양한 세포에서 발현되어 염증 반응, 조직 재형성, 상처 치유, 종양 성장 및 전이에 관여합니다. 또한 type IV 및 V 콜라겐을 분해하며, 골수 유래 세포에서 공급되어 피부암 발생에도 기여합니다.
연구 결과, MMP9의 증가가 특발성 심방세동 및 대동맥류 진행과 관련이 있음이 보고되었습니다.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.