원본
Thermo Fisher Scientific RPA70 Polyclonal Antibody
상품 한눈에 보기
Thermo Fisher Scientific의 RPA70 폴리클로날 항체는 인간 RPA70 단백질을 인식하며, Western blot, ICC/IF, Flow Cytometry에 적합합니다. 고순도 항원 친화 크로마토그래피로 정제되어 높은 특이성과 재현성을 제공합니다. 연구용으로만 사용됩니다.
- 카탈로그번호
- PA579933
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 02. 오후 11:55
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA579933 RPA70 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific RPA70 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunocytochemistry (ICC/IF) | 5 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to a sequence at the C-terminus of human RPA70 (533–568aa QESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFR) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747048 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
RPA70 plays an essential role in several cellular processes in DNA metabolism including replication, recombination, and DNA repair. It binds and stabilizes single-stranded DNA intermediates, preventing complementary DNA strands from reannealing.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific RTEL1 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific p53R2 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific RUNX3 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific RRM2 Polyclonal Antibody568,000원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.