Thermo Fisher Scientific RPA70 Polyclonal Antibody
Thermo Fisher Scientific의 RPA70 폴리클로날 항체는 인간 RPA70 단백질을 인식하며, Western blot, ICC/IF, Flow Cytometry에 적합합니다. 고순도 항원 친화 크로마토그래피로 정제되어 높은 특이성과 재현성을 제공합니다. 연구용으로만 사용됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunocytochemistry (ICC/IF) | 5 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to a sequence at the C-terminus of human RPA70 (533–568aa QESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFR) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747048 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
RPA70 plays an essential role in several cellular processes in DNA metabolism including replication, recombination, and DNA repair. It binds and stabilizes single-stranded DNA intermediates, preventing complementary DNA strands from reannealing.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific RTEL1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific p53R2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific RPA70 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific RUNX3 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific RRM2 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|