원본

Thermo Fisher Scientific RRM2 Polyclonal Antibody

상품 한눈에 보기

Thermo Fisher Scientific의 RRM2 Polyclonal Antibody는 인간, 마우스, 랫트에 반응하며 Western blot 및 IHC(P) 분석에 적합합니다. 항원 친화 크로마토그래피로 정제되어 높은 특이성과 재현성을 제공합니다. 세포주기 의존적 RRM2 단백질 연구에 활용됩니다.

카탈로그번호: PA579937
브랜드: Thermo Fisher Scientific
카테고리: Polyclonal Antibodies
판매단위: pk

카탈로그

1개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

마지막 업데이트 2025. 08. 02. 오후 09:31

카탈로그 번호 · 상품 설명출고판매가담기

Thermo Fisher Scientific PA579937 RRM2 Polyclonal Antibody 100 ug pk판매 단위 pk ·

재고 확인 필요재고 확인 필요

568,000원VAT 포함 624,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Thermo Fisher Scientific · Thermo Fisher Scientific RRM2 Polyclonal Antibody

Applications

Application	Tested Dilution	Publications
Western Blot (WB)	0.1–0.5 µg/mL	View 1 publication
Immunohistochemistry (Paraffin) (IHC (P))	0.5–1 µg/mL	-

Product Specifications

항목	내용
Species Reactivity	Human, Mouse, Rat
Published Species	Mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	A synthetic peptide corresponding to a sequence at the N-terminus of human RRM2 (1–33aa MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENT)
Conjugate	Unconjugated
Form	Lyophilized
Concentration	500 µg/mL
Purification	Antigen affinity chromatography
Storage Buffer	PBS with 5 mg BSA
Contains	0.05 mg sodium azide
Storage Conditions	-20°C
Shipping Conditions	Ambient (domestic); Wet ice (international)
RRID	AB_2747052