Atlas Antibodies Anti-ITGA2B Antibody
상품 옵션 정보 | ||||||||
---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA031170-100 | - | Atlas Antibodies HPA031170-100 Anti-ITGA2B Antibody, integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41) 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
HPA031170-25 | - | Atlas Antibodies HPA031170-25 Anti-ITGA2B Antibody, integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41) 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 |
다른 상품 둘러보기
Anti-ITGA2B Antibody
integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human ITGA2B
Alternative Gene Names
CD41, CD41B, GP2B, PPP1R93
Target Protein
integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41)
Target Gene
ITGA2B
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
CVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRV
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Mouse ENSMUSG00000034664 (81%)
Rat ENSRNOG00000022071 (77%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet
)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|