CacheBy
Atlas Antibodies Anti-ITGA2B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ITGA2B Antibody

상품 한눈에 보기

인간 ITGA2B 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 RNA-seq 데이터 기반 정교한 검증 수행. 고순도 PrEST 항원 친화 정제 방식 적용. CD41 관련 혈소판 단백질 연구에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA031168-100 Anti-ITGA2B Antibody, integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031168-25 Anti-ITGA2B Antibody, integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ITGA2B Antibody

Anti-ITGA2B Antibody

integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human ITGA2B

Alternative Gene Names

CD41, CD41B, GP2B, PPP1R93

Open Datasheet

Target Information

항목 내용
Target Protein integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41)
Target Gene ITGA2B
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence CVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRV
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000034664 (81%), Rat ENSRNOG00000022071 (77%)

Antibody Information

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Tooltip Orthogonal

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.