CacheBy
Atlas Antibodies Anti-ITGA2B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ITGA2B Antibody

상품 한눈에 보기

Human ITGA2B 단백질을 인식하는 Rabbit Polyclonal 항체로, CD41 (platelet glycoprotein IIb) 검출에 사용됩니다. IHC 등 다양한 응용에 적합하며, PrEST 항원으로 정제된 고특이성 항체입니다. Human에 대한 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA031169-100 Anti-ITGA2B Antibody, integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031169-25 Anti-ITGA2B Antibody, integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ITGA2B Antibody

Anti-ITGA2B Antibody

Target: integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human ITGA2B


Alternative Gene Names

CD41, CD41B, GP2B, PPP1R93

Open Datasheet


Target Information

항목 내용
Target Protein integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41)
Target Gene ITGA2B
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
CVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRV
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000034664 (81%)
Rat ENSRNOG00000022071 (77%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.