
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ITGA2B Antibody
상품 한눈에 보기
Human ITGA2B 단백질을 인식하는 폴리클로날 래빗 항체로, IHC 및 RNA-seq 비교를 통한 정교한 단백질 발현 검증에 적합함. CD41 등 대체 유전자명으로 알려진 혈소판 글리코프로틴 IIb/IIIa 복합체 표적. 고순도 Affinity 정제 방식 적용.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA031171-100 Anti-ITGA2B Antibody, integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031171-25 Anti-ITGA2B Antibody, integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ITGA2B Antibody
Anti-ITGA2B Antibody
Target: integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human ITGA2B
Alternative Gene Names
CD41, CD41B, GP2B, PPP1R93
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41) |
| Target Gene | ITGA2B |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000034664 (81%), Rat ENSRNOG00000022071 (77%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Antigen Sequence
CVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRV
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



