CacheBy
Atlas Antibodies Anti-ITGA2B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ITGA2B Antibody

상품 한눈에 보기

Human ITGA2B 단백질을 인식하는 폴리클로날 래빗 항체로, IHC 및 RNA-seq 비교를 통한 정교한 단백질 발현 검증에 적합함. CD41 등 대체 유전자명으로 알려진 혈소판 글리코프로틴 IIb/IIIa 복합체 표적. 고순도 Affinity 정제 방식 적용.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA031171-100 Anti-ITGA2B Antibody, integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031171-25 Anti-ITGA2B Antibody, integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ITGA2B Antibody

Anti-ITGA2B Antibody

Target: integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human ITGA2B

Alternative Gene Names

CD41, CD41B, GP2B, PPP1R93

Open Datasheet

Target Information

항목 내용
Target Protein integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41)
Target Gene ITGA2B
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000034664 (81%), Rat ENSRNOG00000022071 (77%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Antigen Sequence

CVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRV

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.