CacheBy
Atlas Antibodies Anti-IL31RA Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IL31RA Antibody

상품 한눈에 보기

Human IL31RA를 인식하는 토끼 폴리클로날 항체로, interleukin 31 receptor A 단백질 검출에 사용됩니다. PrEST 항원으로 정제되었으며, IHC 등 다양한 응용에 적합합니다. Human에 특이적으로 반응하며, 사용 전 부드럽게 혼합하여 사용합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA068114-100 Anti-IL31RA Antibody, interleukin 31 receptor A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA068114-25 Anti-IL31RA Antibody, interleukin 31 receptor A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IL31RA Antibody

Anti-IL31RA Antibody

Target: interleukin 31 receptor A (IL31RA)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against Human IL31RA.


Alternative Gene Names

CRL, CRL3, GLM-R, Glmr, IL-31RA

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein interleukin 31 receptor A
Target Gene IL31RA
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence ILKPCSTPSDKLVIDKLVVNFGNVLQEIFTDEARTGQENNLGGEKNGYVTCPFRPDCPLGKSFEELPVSPEIPPRKSQYLR

Verified Species Reactivity

  • Human

Interspecies Information

Ortholog ID 항원 서열 일치율
Mouse ENSMUSG00000050377 52%
Rat ENSRNOG00000042080 51%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.