Atlas Antibodies Anti-IL1R2 Antibody

상품 한눈에 보기

Human IL1R2 단백질을 타깃으로 하는 Rabbit Polyclonal 항체. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 Affinity 정제됨. 고순도 IgG, PBS/glycerol buffer에 보존제로 sodium azide 포함.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA027598-100 Anti-IL1R2 Antibody, interleukin 1 receptor, type II 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA027598-25 Anti-IL1R2 Antibody, interleukin 1 receptor, type II 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: interleukin 1 receptor, type II (IL1R2)
Supplier: Atlas Antibodies

Polyclonal Antibody against Human IL1R2

항목	내용
Target Protein	interleukin 1 receptor, type II
Target Gene	IL1R2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000014378 (54%), Mouse ENSMUSG00000026073 (48%)

Antigen Sequence:
AARSCRFRGRHYKREFRLEGEPVALRCPQVPYWLWASVSPRINLTWHKNDSARTVPGEEETRMWAQD

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet