CacheBy
Atlas Antibodies Anti-IL2RA Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IL2RA Antibody

상품 한눈에 보기

인간 IL2RA 단백질을 인식하는 토끼 폴리클로날 항체. IHC 등에서 단백질 발현 검증에 적합. RNA-seq 데이터 기반 직교 검증 수행. 고순도 Affinity 정제 항체로 다양한 연구에 활용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA054622-100 Anti-IL2RA Antibody, interleukin 2 receptor, alpha 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054622-25 Anti-IL2RA Antibody, interleukin 2 receptor, alpha 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IL2RA Antibody

Anti-IL2RA Antibody

Target: Interleukin 2 receptor, alpha (IL2RA)
Type: Polyclonal Antibody against Human IL2RA


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody targeting human interleukin 2 receptor, alpha (IL2RA).


Alternative Gene Names

CD25, IDDM10, IL2R

Open Datasheet


Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    YKEGTMLNCECKRGFRRIKSGSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQP

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000047647 57%
Mouse ENSMUSG00000026770 57%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.