CacheBy
Atlas Antibodies Anti-IL2RG Antibody
원본

Atlas Antibodies Anti-IL2RG Antibody

상품 한눈에 보기

Human IL2RG 단백질을 인식하는 토끼 폴리클로날 항체로, interleukin 2 receptor gamma를 타겟으로 함. 다양한 면역학 연구 및 단백질 발현 분석에 적합. 높은 특이성과 신뢰성 있는 검출 성능 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA049691-100 Anti-IL2RG Antibody, interleukin 2 receptor, gamma 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049691-25 Anti-IL2RG Antibody, interleukin 2 receptor, gamma 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IL2RG Antibody

Anti-IL2RG Antibody

Target Information

  • Target Protein: interleukin 2 receptor, gamma
  • Target Gene: IL2RG
  • Alternative Gene Names: CD132, CIDX, IMD4, SCIDX1

면역세포 내 단백질 발현 분석 및 면역형광 염색 등 다양한 면역학 연구에 사용 가능.

Product Description

Polyclonal antibody against Human IL2RG.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

TFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFAL

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000003954 78%
Mouse ENSMUSG00000092463 73%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
MSDS Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.