Thermo Fisher Scientific ATG14 Polyclonal Antibody
ATG14 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody로, Western blot 및 IHC(P) 분석에 적합. 인간 및 랫트 반응성, 항원 친화 크로마토그래피로 정제, 동결건조 형태로 제공. 연구용으로만 사용 가능.
- 카탈로그번호
- PA578833
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific ATG14 Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P))
- Tested Dilution: 0.5–1 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human ATG14L (70–101aa RDRERFIDKKERLSRLKSKQEEFQKEVLKAME) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745949 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
ATG14 (Autophagy related protein homolog 14)는 인간 14번 염색체에 위치한 ATG14 유전자에 의해 암호화되며, ATG14L 또는 BARKOR(Beclin 1-associated autophagy-related key regulator)로도 알려져 있습니다.
자가포식(autophagy)은 진화적으로 보존된 과정으로, 잘못 접힌 단백질과 기능이 저하된 세포 소기관을 재활용 및 분해합니다.
영양 스트레스 시 자가포식이 유도되며, 오토파고좀 형성 → 리소좀과의 융합 → 오토파골리소좀 형성 단계를 거칩니다.
Class III PI3-Kinase(Vps34)와 Beclin 1은 ATG14(type 1) 또는 UVRAG(type 2)를 포함하는 복합체를 형성하며, Atg14는 type 1 복합체를 preautophagosomal structure(PAS)로 안내하여 오토파고좀 형성 개시를 조절합니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.