Thermo Fisher Scientific ASL Polyclonal Antibody
Thermo Fisher Scientific ASL Polyclonal Antibody는 인간, 마우스, 랫트에 반응하며 Western blot에 적합합니다. 합성 펩타이드 면역원으로 제작된 Rabbit IgG 폴리클로날 항체입니다. 항원 친화 크로마토그래피로 정제되었으며, -20°C에서 보관합니다. 연구용으로만 사용됩니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific ASL Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human Argininosuccinate Lyase (ASL) — YTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRIN |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2745942 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
ASL encodes a member of the lyase 1 family. The encoded protein forms a cytosolic homotetramer and catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate — an essential step in the urea cycle for detoxifying ammonia in the liver.
Mutations in this gene cause the autosomal recessive disorder argininosuccinic aciduria (argininosuccinic acid lyase deficiency).
A nontranscribed pseudogene is located on chromosome 22q.
Alternatively spliced transcript variants encoding different isoforms have been described.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.