
Thermo Fisher Scientific ASL Polyclonal Antibody
Thermo Fisher Scientific ASL Polyclonal Antibody는 인간, 마우스, 랫트에 반응하며 Western blot에 적합합니다. 합성 펩타이드 면역원으로 제작된 Rabbit IgG 폴리클로날 항체입니다. 항원 친화 크로마토그래피로 정제되었으며, -20°C에서 보관합니다. 연구용으로만 사용됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human Argininosuccinate Lyase (ASL) — YTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRIN |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2745942 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
ASL encodes a member of the lyase 1 family. The encoded protein forms a cytosolic homotetramer and catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate — an essential step in the urea cycle for detoxifying ammonia in the liver.
Mutations in this gene cause the autosomal recessive disorder argininosuccinic aciduria (argininosuccinic acid lyase deficiency).
A nontranscribed pseudogene is located on chromosome 22q.
Alternatively spliced transcript variants encoding different isoforms have been described.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific ATG14 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific ATF1 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific ASL Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific ASPH Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific beta Arrestin 1 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|