Thermo Fisher Scientific ATF4 Polyclonal Antibody
Rabbit polyclonal antibody against human ATF4, validated for WB and IHC applications. Lyophilized form, reconstitutable to 500 µg/mL. High specificity via antigen affinity purification. Suitable for research use only.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific ATF4 Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P))
- Tested Dilution: 0.5–1 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to human ATF4 (KELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2745948 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The ATF4 gene encodes a transcription factor originally identified as a mammalian DNA-binding protein that interacts with the tax-responsive enhancer element in the LTR of HTLV-1. It is also known as cAMP-response element-binding protein 2 (CREB-2).
ATF4 belongs to a family of DNA-binding proteins including AP-1, CREBs, and CREB-like proteins. These transcription factors share a leucine zipper region for protein-protein interactions and a basic amino acid stretch functioning as a DNA-binding domain.
Two alternative transcripts encoding the same protein have been described. Two pseudogenes are located on the X chromosome at q28 within a large inverted duplication region.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.