
Thermo Fisher Scientific ATF4 Polyclonal Antibody
Rabbit polyclonal antibody against human ATF4, validated for WB and IHC applications. Lyophilized form, reconstitutable to 500 µg/mL. High specificity via antigen affinity purification. Suitable for research use only.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P))
- Tested Dilution: 0.5–1 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to human ATF4 (KELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2745948 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The ATF4 gene encodes a transcription factor originally identified as a mammalian DNA-binding protein that interacts with the tax-responsive enhancer element in the LTR of HTLV-1. It is also known as cAMP-response element-binding protein 2 (CREB-2).
ATF4 belongs to a family of DNA-binding proteins including AP-1, CREBs, and CREB-like proteins. These transcription factors share a leucine zipper region for protein-protein interactions and a basic amino acid stretch functioning as a DNA-binding domain.
Two alternative transcripts encoding the same protein have been described. Two pseudogenes are located on the X chromosome at q28 within a large inverted duplication region.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific ATF2 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific SERCA1 ATPase Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific ATF4 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific ATG14 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific ATF1 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|