Thermo Fisher Scientific TGF beta-2 Polyclonal Antibody

Thermo Fisher Scientific TGF beta-2 Polyclonal Antibody

상품 한눈에 보기

TGF beta-2에 특이적인 Rabbit Polyclonal Antibody로, WB 및 IHC(P) 응용에 적합합니다. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공됩니다. 인간 시료 반응성이 있으며 연구용으로만 사용 가능합니다.

상품 옵션 정보

다양한 옵션의 상품 정보와 가격을 확인하세요

마지막 업데이트
2025. 08. 05. PM 09:18
소모품
PA580117
Thermo Fisher Scientific PA580117 TGF beta-2 Polyclonal Antibody 100 ug pk
CAS: -단위: pk
재고문의재고: -
568,000
(VAT포함)624,800
소모품
PA580117
재고문의재고: -
Thermo Fisher Scientific PA580117 TGF beta-2 Polyclonal Antibody 100 ug pk
CAS: -단위: pk
568,000
(VAT포함)624,800

AI 추천 연관 상품

AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요

연관 상품을 찾고 있습니다...

Applications

Application Tested Dilution Publications
Western Blot (WB) 0.1–0.5 µg/mL -
Immunohistochemistry (Paraffin) (IHC (P)) 0.5–1 µg/mL -

Product Specifications

Specification Description
Species Reactivity Human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence of human TGF beta 2 (ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPK)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS with 4 mg trehalose
Contains 0.05 mg sodium azide
Storage Conditions -20°C
Shipping Conditions Wet ice
RRID AB_2747232

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

Transforming Growth Factor (TGF) betas mediate numerous cell-to-cell interactions during embryonic development. Three TGF betas (TGF beta 1, TGF beta 2, and TGF beta 3) have been identified in mammals. Each is synthesized as a precursor protein cleaved to yield a 112 amino acid polypeptide associated with the latent portion of the molecule.

TGF beta polypeptides are multifunctional and influence cell proliferation, differentiation, and other cellular functions. Both transformed and nonneoplastic tissues release transforming growth factors, and nearly all mammalian cells possess specific TGF receptors.

The multimodal nature of TGF beta is reflected in its ability to either stimulate or inhibit cellular proliferation. Generally, mesenchymal cells are stimulated, while epithelial or neuroectodermal cells are inhibited. TGF beta 1, TGF beta 2, and TGF beta 3 exhibit similar biological activities, with some variation in receptor binding. TGF beta 2 is produced by many cell types and found at high concentrations in porcine platelets and mammalian bone. Latent TGF beta 2 is the predominant isoform in body fluids such as amniotic fluid, breast milk, and ocular humors.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

제품 이미지

(이미지 없음)


배송/결제/교환/반품 안내

배송 정보

기본 배송비
  • - 배송비 3,850원 (부가세 포함)
  • - 10만원 이상 구매시 배송비 무료
  • - 도서산간 및 제주를 포함한 일부 지역 추가비용 발생
  • - 장비의 경우 추가 배송비 및 설치비가 청구 될 수 있습니다
교환/반품 배송비
  • - 상품 별로 상이
착불 배송비
  • - 착불 적용 상품에 개별 부과 (상품 별로 상이)
교환/반품 배송비
  • - 상품 별로 상이

결제 및 환불 안내

결제수단
  • - 신용카드
  • - 가상계좌
  • - 연구비카드
  • - 세금계산서 (기업은행 033-502993-01-019)
  • - 세금계산서 (신한은행 100-032-703829)
  • - 상품 결제 후 최대 60일 이내 제공 완료
취소
  • - 취소 접수 후 3 ~ 5일 이내 환불 처리
반품
  • - 반품 접수 후 3 ~ 5일 이내 환불 처리
환급
  • - 회사는 회원이 구매신청한 상품 등이 품절 등의 사유로 인도 또는 제공할 수 없을 때에는 지체 없이 그 사유를 회원에게 통지하고,
      사전에 상품 등의 대금을 받은 경우에는 대금을 받은 날로부터 3영업일 이내에 환급하거나 환급에 필요한 조치를 취합니다.

교환 및 반품 접수

교환 및 반품 접수 기한
  • - 상품 수령일로부터 7일 이내
교환 및 반품 접수가 가능한 경우
  • - 제품의 하자는 없지만, 다른 상품으로 교환하거나 반품 원하는 경우
     (배송비 고객 부담)
  • - 상품자체 불량 및 하자에 의한 경우
  • - 상품 오배송에 의한 경우
교환 및 반품 접수가 불가능한 경우
  • - 상품 수령 후 7일을 초과한 경우
  • - 개별 포장 상품의 포장을 훼손한 경우
  • - 고객의 고의적인 귀책으로 상품가치가 훼손된 경우
  • - 주문제작을 통해서 제품을 생산하는 경우
  • - 주문 당시 재고가 없어서 해외를 통해 제품을 수입해서 구매하는 경우

교환 및 반품 신청

교환 절차
  • - 상품 불량/오배송/상품파손
  • - 전화(02-585-1342) 또는 info@cacheby.com에 상품교환 접수
반품 절차
  • - 반품할 품목을 확인 후 info@cacheby.com로 반품 신청 (수령 후 7일 이내 가능하며 이후 불가)
  • - 전달드린 주문번호와 함께 반품 상품을 포장
     (포장을 꼼꼼하게 해주셔야 반품 상품 손상에 따른 불이익이 없습니다.)
  • - 택배회사 방문 시 반품 상품 전달
     (택배사의 반송장은 상품 교환이 완료될 때까지 보관해주시기 바랍니다.)
  • - 회수된 제품 확인 후 하자없을시 배송비를 제외하고 환불 처리 진행
     (환불 처리 후 입금까지 최대 2주까지 소요될 수 있습니다.)

문의 0