
Thermo Fisher Scientific TGF beta-2 Polyclonal Antibody
TGF beta-2에 특이적인 Rabbit Polyclonal Antibody로, WB 및 IHC(P) 응용에 적합합니다. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공됩니다. 인간 시료 반응성이 있으며 연구용으로만 사용 가능합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific TGF beta-2 Polyclonal Antibody
Applications
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL | - |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL | - |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human TGF beta 2 (ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2747232 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Transforming Growth Factor (TGF) betas mediate numerous cell-to-cell interactions during embryonic development. Three TGF betas (TGF beta 1, TGF beta 2, and TGF beta 3) have been identified in mammals. Each is synthesized as a precursor protein cleaved to yield a 112 amino acid polypeptide associated with the latent portion of the molecule.
TGF beta polypeptides are multifunctional and influence cell proliferation, differentiation, and other cellular functions. Both transformed and nonneoplastic tissues release transforming growth factors, and nearly all mammalian cells possess specific TGF receptors.
The multimodal nature of TGF beta is reflected in its ability to either stimulate or inhibit cellular proliferation. Generally, mesenchymal cells are stimulated, while epithelial or neuroectodermal cells are inhibited. TGF beta 1, TGF beta 2, and TGF beta 3 exhibit similar biological activities, with some variation in receptor binding. TGF beta 2 is produced by many cell types and found at high concentrations in porcine platelets and mammalian bone. Latent TGF beta 2 is the predominant isoform in body fluids such as amniotic fluid, breast milk, and ocular humors.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
