Thermo Fisher Scientific TGF beta-2 Polyclonal Antibody
TGF beta-2에 특이적인 Rabbit Polyclonal Antibody로, WB 및 IHC(P) 응용에 적합합니다. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공됩니다. 인간 시료 반응성이 있으며 연구용으로만 사용 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL | - |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL | - |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human TGF beta 2 (ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2747232 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Transforming Growth Factor (TGF) betas mediate numerous cell-to-cell interactions during embryonic development. Three TGF betas (TGF beta 1, TGF beta 2, and TGF beta 3) have been identified in mammals. Each is synthesized as a precursor protein cleaved to yield a 112 amino acid polypeptide associated with the latent portion of the molecule.
TGF beta polypeptides are multifunctional and influence cell proliferation, differentiation, and other cellular functions. Both transformed and nonneoplastic tissues release transforming growth factors, and nearly all mammalian cells possess specific TGF receptors.
The multimodal nature of TGF beta is reflected in its ability to either stimulate or inhibit cellular proliferation. Generally, mesenchymal cells are stimulated, while epithelial or neuroectodermal cells are inhibited. TGF beta 1, TGF beta 2, and TGF beta 3 exhibit similar biological activities, with some variation in receptor binding. TGF beta 2 is produced by many cell types and found at high concentrations in porcine platelets and mammalian bone. Latent TGF beta 2 is the predominant isoform in body fluids such as amniotic fluid, breast milk, and ocular humors.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific Tyrosine Hydroxylase Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Thrombospondin 1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific TGF beta-2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific TFAM Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific TFF1 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|