Thermo Fisher Scientific Tyrosine Hydroxylase Polyclonal Antibody
Tyrosine Hydroxylase 단백질을 인식하는 Rabbit Polyclonal 항체로, WB, IHC(P), ICC/IF에 사용 가능. 인간, 마우스, 랫트 반응성. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공. 카테콜아민 신경전달물질 합성 연구에 적합.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 2–5 µg/mL |
| Immunocytochemistry (ICC/IF) | 5 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human Tyrosine Hydroxylase (193–222aa: KVPWFPRKVSELDKCHHLVTKFDPDLDLDH) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747235 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Tyrosine hydroxylase (TH) is an enzyme involved in the synthesis of catecholamine neurotransmitters such as dopamine, epinephrine, and norepinephrine. Catecholamine synthesis is regulated by the interaction of TH with its cofactor tetrahydrobiopterin (BH4), which binds to the TH catalytic domain to activate the enzyme.
In humans, four TH mRNA splice variants (hTH1–hTH4) have been identified, sharing identical catalytic domains but differing in their N-terminal regulatory regions. TH catalyzes the conversion of L-tyrosine to L-dopa and plays a crucial role in adrenergic neuron physiology. Dysregulation of TH is associated with neurological and cardiovascular diseases including Parkinson’s disease, schizophrenia, Segawa syndrome, dystonia, and others.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific Thrombopoietin Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Thrombospondin 2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Tyrosine Hydroxylase Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Thrombospondin 1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific TGF beta-2 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|